Learn More
Learn More
Learn More
Learn More
Learn More
Resources » Reference Databases » Citations Database
Products/Services Used | Details | Operation |
---|---|---|
Catalog Products> | ... Fish were injected intraperitoneally with synthetic goldfish nesfatin-1 (gfnesfatin-1; VPISIDKTKVKLPEETVKES PQNVDTGLHYDRYLREVIDFLEKDQHFREKLHNTDMEDIKQGK LAKELDFVSHHVRTKLDEL; GenScript, NJ) ( Gonzalez et al., 2010 and Kerbel and Unniappan, ... | Get A Quote |
Nesfatin-1 is an 82 amino acid peptide that inhibits food intake in rodents and fish. While endogenous nesfatin-1, and its role in the regulation of food intake and hormone secretion has been reported in fish, information on cardiovascular functions of nesfatin-1 in fish is in its infancy. We hypothesized that cardiac NUCB2 expression is meal responsive and nesfatin-1 is a cardioregulatory peptide in zebrafish. NUCB2/nesfatin-1 like immunoreactivity was detected in zebrafish cardiomyocytes. Real-time quantitative PCR analysis found that the cardiac expression of NUCB2A mRNA in unfed fish decreased at 1h post-regular feeding time. Food deprivation for 7days did not change NUCB2A mRNA expression. However, NUCB2B ... More