For each citation that was shared on social media (LinkedIn, Facebook, or Twitter) with the “@GenScript” tag, the author will be rewarded with a $10 Amazon gift card or 2,000 GS points.

Structural plasticity of calmodulin on the surface of CaF2 nanoparticles preserves its biological function

Nanoscale. 2015; 
Astegno A, Maresi E, Marino V, Dominici P, Pedroni M, Piccinelli F, Dell'Orco D.
Products/Services Used Details Operation
Peptide Synthesis … The 32 amino acid polypeptide encompassing the putative C-terminal CaM-binding domain of Gad1 (CBD) was chemically synthesized by GenScript Corporation. The sequence was as follows: VTVKKSDIDKQRDIITGWKKFVADRKKTSGIC … Get A Quote

Abstract

Nanoparticles are increasingly used in biomedical applications and are especially attractive as biocompatible and biodegradable protein delivery systems. Herein, the interaction between biocompatible 25 nm CaF2 nanoparticles and the ubiquitous calcium sensor calmodulin has been investigated in order to assess the potential of these particles to serve as suitable surface protein carriers. Calmodulin is a multifunctional messenger protein that activates a wide variety of signaling pathways in eukaryotic cells by changing its conformation in a calcium-dependent manner. Isothermal titration calorimetry and circular dichroism studies have shown that the interaction between calmodulin and CaF2 nanoparticles occurs wi... More

Keywords