For each citation that was shared on social media (LinkedIn, Facebook, or Twitter) with the “@GenScript” tag, the author will be rewarded with a $10 Amazon gift card or 2,000 GS points.

Dual peptide-mediated targeted delivery of bioactive siRNAs to oral cancer cells in vivo.

Oral Oncol.. 2017-09; 
Alexander-Bryant AA, Zhang H, Attaway CC, Pugh W, Eggart L, Sansevere RM, Andino LM, Dinh L, Cantini LP, Jakymiw A.
Products/Services Used Details Operation
Peptide Synthesis ... Peptide synthesis. The 599 (GLFEAIEGFIENGWEGMIDGWYGGGGRRRRRRRRRK) and GE11R9 (YHWYGYTPQNVIGGGGRRRRRRRRRK) peptides were synthesized and purified (>95% purity) by high-performance liquid chromatography at GenScript USA, Inc. ... Get A Quote

Abstract

OBJECTIVES: Despite significant advances in cancer treatment, the prognosis for oral cancer remains poor in comparison to other cancer types, including breast, skin, and prostate. As a result, more effective therapeutic modalities are needed for the treatment of oral cancer. Consequently, in the present study, we examined the feasibility of using a dual peptide carrier approach, combining an epidermal growth factor receptor (EGFR)-targeting peptide with an endosome-disruptive peptide, to mediate targeted delivery of small interfering RNAs (siRNAs) into EGFR-overexpressing oral cancer cells and induce silencing of the targeted oncogene, cancerous inhibitor of protein phosphatase 2A (CIP2A). MATERIALS AND METHODS... More

Keywords

CIP2A; Cell-penetrating; EGFR; Endosome-disruptive; Homing/targeting; OSCC; Oral cancer; Peptide; RNAi; siRNA