Catalog Products » Catalog Peptide » All Catalog Peptides » Glucagon-Like Peptide (GLP) I (7-37)
Glucagon-Like Peptide (GLP) I (7-37)

Glucagon-Like Peptide (GLP) I (7-37)

GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone.
RP12738
$119.00

Ask us a question
Overview
Synonyms Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide
Synonyms Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide
Description GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone.
Description GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone.
Sequence
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}
{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}
{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}{GLY}
Sequence
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}
{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}
{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}{GLY}
Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Molecular Formula C151H228N40O47
Molecular Formula C151H228N40O47
Molecular Weight 3355.68
Molecular Weight 3355.68

Properties
Purity > 95%
Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Form Lyophilized
Form Lyophilized
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.
Note Potent Insulin secretagogue.
Note Potent Insulin secretagogue.

Examples
  • Glucagon-Like Peptide (GLP) I (7-37)
    • Glucagon-Like Peptide (GLP) I (7-37)