Catalog Products » Catalog Peptide » All Catalog Peptides » Luteinizing Hormone Releasing Hormone (LH-RH), human

Luteinizing Hormone Releasing Hormone (LH-RH), human

LH-RH (human), a hypothalamic peptide, is involved in the regulation of reproductive functions by controlling the synthesis and release of luteinizing hormone (LH) and follicle-stimulating hormone (FSH) from the anterior pituitary gland.
RP11937
$33.00

Ask us a question
Overview
Synonyms LH-RH, humanLH-RH
Synonyms LH-RH, humanLH-RH
Description LH-RH (human), a hypothalamic peptide, is involved in the regulation of reproductive functions by controlling the synthesis and release of luteinizing hormone (LH) and follicle-stimulating hormone (FSH) from the anterior pituitary gland.
Description LH-RH (human), a hypothalamic peptide, is involved in the regulation of reproductive functions by controlling the synthesis and release of luteinizing hormone (LH) and follicle-stimulating hormone (FSH) from the anterior pituitary gland.
Cas No 71447-49-9
Cas No 71447-49-9
Sequence
{pGLU}{HIS}{TRP}{SER}{TYR}{GLY}{LEU}{ARG}{PRO}{GLY}-NH2
Sequence
{pGLU}{HIS}{TRP}{SER}{TYR}{GLY}{LEU}{ARG}{PRO}{GLY}
Sequence Shortening DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVDAEFRHDSGYEVHHQKLVF
Sequence Shortening {pGLU}HWSYGLRPG
Molecular Formula C55H75N17O13
Molecular Formula C55H75N17O13
C Terminal NH2
C Terminal Amidation
Molecular Weight 1182.29
Molecular Weight 1182.29

Properties
Purity > 95%
Purity > 95%
Solubility Solubility in Water: 25 mg/ml H2O clear, very faintly yellow.
Solubility Solubility in Water: 25 mg/ml H2O clear, very faintly yellow.
Form Lyophilized
Form Lyophilized
Storage Store the peptide at -20°C. Keep container tightly closed.
Storage Store the peptide at -20°C. Keep container tightly closed.