Catalog Products » Catalog Peptide » All Catalog Peptides » Prolactin Releasing Peptide (1-31), human

Prolactin Releasing Peptide (1-31), human

GenScript Prolactin-releasing peptide is a specific prolactin releasing peptide. GenScript prolactin-releasing peptide (PrRP) was originally isolated as an endogenous hypothalamic ligand for the hGR3 orphan receptor and has been shown to release prolactin from dispersed pituitaries harvested from lactating female rats and only at very high doses in cycling females. PrRPs have no effect on prolactin production from dispersed pituitary cells harvested from males.
RP11861
$190.00

Ask us a question
Overview
Synonyms PrRP
Synonyms PrRP
Description GenScript Prolactin-releasing peptide is a specific prolactin releasing peptide. GenScript prolactin-releasing peptide (PrRP) was originally isolated as an endogenous hypothalamic ligand for the hGR3 orphan receptor and has been shown to release prolactin from dispersed pituitaries harvested from lactating female rats and only at very high doses in cycling females. PrRPs have no effect on prolactin production from dispersed pituitary cells harvested from males.
Description GenScript Prolactin-releasing peptide is a specific prolactin releasing peptide. GenScript prolactin-releasing peptide (PrRP) was originally isolated as an endogenous hypothalamic ligand for the hGR3 orphan receptor and has been shown to release prolactin from dispersed pituitaries harvested from lactating female rats and only at very high doses in cycling females. PrRPs have no effect on prolactin production from dispersed pituitary cells harvested from males.
Sequence
{SER}{ARG}{THR}{HIS}{ARG}{HIS}{SER}{MET}{GLU}{ILE}{ARG}{THR}{PRO}{ASP}{ILE}{ASN}{PRO}{ALA}{TRP}{TYR}{ALA}{SER}{ARG}{GLY}{ILE}{ARG}{PRO}{VAL}{GLY}{ARG}{PHE}-NH2
Sequence
{SER}{ARG}{THR}{HIS}{ARG}{HIS}{SER}{MET}{GLU}{ILE}{ARG}{THR}{PRO}{ASP}{ILE}{ASN}{PRO}{ALA}{TRP}{TYR}{ALA}{SER}{ARG}{GLY}{ILE}{ARG}{PRO}{VAL}{GLY}{ARG}{PHE}-NH2
Sequence Shortening SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
Sequence Shortening SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
Molecular Formula C160H252N56O42S1
Molecular Formula C160H252N56O42S1
C Terminal NH2
C Terminal NH2
Molecular Weight 3664.15
Molecular Weight 3664.15

Properties
Purity > 95%
Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Form Lyophilized
Form Lyophilized
Storage Store the peptide at -20°C. Keep container tightly closed. Store in a cool dry place.
Storage Store the peptide at -20°C. Keep container tightly closed. Store in a cool dry place.