Catalog Products » Catalog Peptide » All Catalog Peptides » Gastrin-Releasing Peptide, human

Gastrin-Releasing Peptide, human

Gastrin-releasing peptide (GRP) is released by the post-ganglionic fibres of the vagus nerve, which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumor marker in the diagnosis of small-cell lung carcinoma.
RP10791
$90.00

Ask us a question
Overview
Description Gastrin-releasing peptide (GRP) is released by the post-ganglionic fibres of the vagus nerve, which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumor marker in the diagnosis of small-cell lung carcinoma.
Description Gastrin-releasing peptide (GRP) is released by the post-ganglionic fibres of the vagus nerve, which innervate the G cells of the stomach and stimulate them to release gastrin. GRP can directly stimulate pepsinogen release from chief cells by a specific GRP receptor that mobilizes intracellular calcium. Gastrin-releasing peptide has a prominent role as a tumor marker in the diagnosis of small-cell lung carcinoma.
Cas No 93755-85-2
Cas No 93755-85-2
Sequence
{VAL}{PRO}{LEU}{PRO}{ALA}{GLY}{GLY}{GLY}{THR}{VAL}{LEU}{THR}{LYS}{MET}{TYR}{PRO}{ARG}{GLY}{ASN}{HIS}{TRP}{ALA}{VAL}{GLY}{HIS}{LEU}{MET}-NH2
Sequence
{VAL}{PRO}{LEU}{PRO}{ALA}{GLY}{GLY}{GLY}{THR}{VAL}{LEU}{THR}{LYS}{MET}{TYR}{PRO}{ARG}{GLY}{ASN}{HIS}{TRP}{ALA}{VAL}{GLY}{HIS}{LEU}{MET}-NH2
Sequence Shortening VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Sequence Shortening VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Molecular Formula C130H204N38O31S2
Molecular Formula C130H204N38O31S2
C Terminal NH2
C Terminal NH2
Molecular Weight 2859.3
Molecular Weight 2859.3

Properties
Purity > 95%
Purity > 95%
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Form Lyophilized
Form Lyophilized
Storage Store the peptide at -20°C. Keep container tightly closed.
Storage Store the peptide at -20°C. Keep container tightly closed.