Catalog Products » Catalog Peptide » All Catalog Peptides » Glucagon-Like Peptide (GLP) I (7-36), amide, human

Glucagon-Like Peptide (GLP) I (7-36), amide, human

Glucagon-Like Peptide I (7-36) (GLP)-1 (7-36)-NH2 is a peptide found in the mucosal endocrine cells of the intestine, and plasma levels of Glucagon-Like Peptide I (7-36)-NH2 immunoreactivity show a rise after the ingestion of a fat or mixed-component meal. The effects of physiological infusion of Glucagon-Like Peptide I (7-36)-NH2 on a submaximal gastric acid secretion in healthy volunteers at a rate known to mimic the observed postprandial rise in plasma concentrations. Some results suggest a novel role for Glucagon-Like Peptide I (7-36)-NH2 as a physiological inhibitor of gastric acid secretion in humans.
RP10773
$90.00

Ask us a question
Overview
Synonyms GLP-1 (7-36), amide, humanGlucagon Like PeptideI; Glucagon Like Peptide 1; Glucagon Like Peptide1; GLP-I; GLPI; GLP-1; GLP1
Synonyms GLP-1 (7-36), amide, humanGlucagon Like PeptideI; Glucagon Like Peptide 1; Glucagon Like Peptide1; GLP-I; GLPI; GLP-1; GLP1
Description Glucagon-Like Peptide I (7-36) (GLP)-1 (7-36)-NH2 is a peptide found in the mucosal endocrine cells of the intestine, and plasma levels of Glucagon-Like Peptide I (7-36)-NH2 immunoreactivity show a rise after the ingestion of a fat or mixed-component meal. The effects of physiological infusion of Glucagon-Like Peptide I (7-36)-NH2 on a submaximal gastric acid secretion in healthy volunteers at a rate known to mimic the observed postprandial rise in plasma concentrations. Some results suggest a novel role for Glucagon-Like Peptide I (7-36)-NH2 as a physiological inhibitor of gastric acid secretion in humans.
Description Glucagon-Like Peptide I (7-36) (GLP)-1 (7-36)-NH2 is a peptide found in the mucosal endocrine cells of the intestine, and plasma levels of Glucagon-Like Peptide I (7-36)-NH2 immunoreactivity show a rise after the ingestion of a fat or mixed-component meal. The effects of physiological infusion of Glucagon-Like Peptide I (7-36)-NH2 on a submaximal gastric acid secretion in healthy volunteers at a rate known to mimic the observed postprandial rise in plasma concentrations. Some results suggest a novel role for Glucagon-Like Peptide I (7-36)-NH2 as a physiological inhibitor of gastric acid secretion in humans.
Cas No 107444-51-9
Cas No 107444-51-9
Sequence
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}-NH2
Sequence
{HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}
{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}
{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}
Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Molecular Formula C149H226N40O45
Molecular Formula C149H226N40O45
C Terminal NH2
C Terminal Amidation
Molecular Weight 3297.5
Molecular Weight 3297.5

Properties
Purity > 95%
Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Form Lyophilized
Form Lyophilized
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.