Catalog Products » Catalog Peptide » Beta Amyloid Peptides » β-Amyloid (25-35)

β-Amyloid (25-35)

Beta-amyloid protein (Abeta), a major component of senile plaques of Alzheimer's disease (AD) in the brain, causes elevation of the intracellular free Ca2+ level and the production of robust free radicals. Beta-amyloid 25-35 induced apoptosis, characterized by decreased cell viability, neuronal DNA condensation, and fragmentation, is associated with an increase in intracellular free Ca2+ level, the accumulation of reactive oxygen species (ROS), and the activation of caspase-3. All of these effects induced by beta-amyloid 25-35 are reversed by genistein.
RP10008
$52.00

Ask us a question
Overview
Synonyms βAmyloid; b-Amyloid; bAmyloid; beta-Amyloid; betaAmyloid
Synonyms βAmyloid; b-Amyloid; bAmyloid; beta-Amyloid; betaAmyloid
Description Beta-amyloid protein (Abeta), a major component of senile plaques of Alzheimer's disease (AD) in the brain, causes elevation of the intracellular free Ca2+ level and the production of robust free radicals. Beta-amyloid 25-35 induced apoptosis, characterized by decreased cell viability, neuronal DNA condensation, and fragmentation, is associated with an increase in intracellular free Ca2+ level, the accumulation of reactive oxygen species (ROS), and the activation of caspase-3. All of these effects induced by beta-amyloid 25-35 are reversed by genistein.
Description Beta-amyloid protein (Abeta), a major component of senile plaques of Alzheimer's disease (AD) in the brain, causes elevation of the intracellular free Ca2+ level and the production of robust free radicals. Beta-amyloid 25-35 induced apoptosis, characterized by decreased cell viability, neuronal DNA condensation, and fragmentation, is associated with an increase in intracellular free Ca2+ level, the accumulation of reactive oxygen species (ROS), and the activation of caspase-3. All of these effects induced by beta-amyloid 25-35 are reversed by genistein.
Cas No 131602-53-4
Cas No 131602-53-4
Sequence
{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}
Sequence
{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}
Sequence Shortening DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence Shortening DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Formula C45H81N13O14S1
Molecular Formula C45H81N13O14S1
Molecular Weight 1060.27
Molecular Weight 1060.27

Properties
Purity > 95%
Purity > 95%
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Solubility The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Form Lyophilized
Form Lyophilized
Storage Store the peptide at -20°C
Storage Store the peptide at -20°C